PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna30725.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 395aa    MW: 44715.5 Da    PI: 6.0448
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna30725.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.83e-191461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+eEd++lvd+++++G g+W+t ++  g+ R++k+c++rw +yl
  mrna30725.1-v1.0-hybrid 14 KGPWTPEEDQKLVDYIQKHGYGNWRTLPKNAGLQRCGKSCRLRWTNYL 61
                             79********************************************97 PP

2Myb_DNA-binding54.92e-1767111147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rgr++ eE+e +v+++  lG++ W++Ia++++ gRt++++k++w+++
  mrna30725.1-v1.0-hybrid  67 RGRFSFEEEETIVQLHSILGNK-WSAIAARLP-GRTDNEIKNYWNTH 111
                              89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-26564IPR009057Homeodomain-like
PROSITE profilePS5129425.485965IPR017930Myb domain
SuperFamilySSF466894.87E-3211108IPR009057Homeodomain-like
SMARTSM007178.3E-141363IPR001005SANT/Myb domain
PfamPF002495.7E-171461IPR001005SANT/Myb domain
CDDcd001677.83E-131661No hitNo description
Gene3DG3DSA:1.10.10.605.8E-2665116IPR009057Homeodomain-like
SMARTSM007173.0E-1666114IPR001005SANT/Myb domain
PROSITE profilePS5129420.29566116IPR017930Myb domain
PfamPF002491.8E-1567111IPR001005SANT/Myb domain
CDDcd001674.85E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MGRSPCCDKN GLKKGPWTPE EDQKLVDYIQ KHGYGNWRTL PKNAGLQRCG KSCRLRWTNY  60
LRPDIKRGRF SFEEEETIVQ LHSILGNKWS AIAARLPGRT DNEIKNYWNT HIRKRLLRMG  120
IDPVTHSPRL DLLDFSSILY NPSHHHHQVN FSRLLGMEQM GLNPELLRLA TSLLSSHRER  180
NSNFFIQNDQ QQQQQQQLCS PQNDQIPLHL VQSSQLQEPF QENAPVCATL DTSAIPFPHE  240
AQPSTITDFS SQNCQISEWQ SNGEVPSDFT ESQYVQLPSL TYYDGSSDNQ IISDISPETS  300
NLYSYNSNNQ NFNFPSVFST PSSSPTPLNS NSTTYFNSGT EDERESYCSN MMKFDIPDIF  360
DDFIHPDIAS EAPAKVPEGF AGGRGRGHLS GPPV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-31121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004293589.10.0PREDICTED: protein ODORANT1-like
TrEMBLD9ZJ641e-169D9ZJ64_MALDO; MYB domain class transcription factor
STRINGVIT_00s0203g00070.t011e-151(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85034127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.11e-109MYB-like 102